PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK31667.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 300aa    MW: 33767.7 Da    PI: 4.7885
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK31667.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.94e-17217276261
                 XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                 ++ +r+rr++kNRe+A rsR+RK+a++ eLe  +++Le+eN++L ke+ee +ke ++  +
  KFK31667.1 217 AAAQRQRRMIKNRESAARSRERKQAYQVELESMAAKLEEENEMLSKEIEEKRKERYQKLM 276
                 5789**********************************************9999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.8E-14214271No hitNo description
SMARTSM003383.3E-12216280IPR004827Basic-leucine zipper domain
PfamPF001703.7E-16217277IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.553218270IPR004827Basic-leucine zipper domain
CDDcd147072.35E-18220266No hitNo description
SuperFamilySSF579592.75E-10220272No hitNo description
PROSITE patternPS000360223238IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MASFKVMRSS TSTNSDLPHR ISSSIRPQQQ QQFKRDLNNT SDDGYGGYSG YDSTPMTVEG  60
ILHDTFASDP PATESTLLDS SMMVTDDTPP DREDDGETAA RGKSVDEVWR EIVSGEESKG  120
MKEETQEEIM TLEDFLAKAA VEGNESEDLD VKIPIPIPNY GFDHSVAPTH NQFQMIDKVE  180
GSIVAFGNGF DVYGGGGGGG TTRGKRARVM VEPLDKAAAQ RQRRMIKNRE SAARSRERKQ  240
AYQVELESMA AKLEEENEML SKEIEEKRKE RYQKLMEFVI PVVEKPIGRR FLRRIRSLEW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534791e-131AK353479.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-45-A18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199221.11e-135basic leucine zipper transcription factor
SwissprotP427774e-70GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A087GP650.0A0A087GP65_ARAAL; Uncharacterized protein
STRINGAT5G44080.11e-134(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-127bZIP family protein